Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDYHV1 Rabbit Polyclonal Antibody (FITC)

WDYHV1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

WDYHV1, C8orf32

UniProt

E5RHC2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human WDYHV1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ENIWKLCEYIKNHDQYPLEECYAVFISNERKMIPIWKQQARPGDGPVIWD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_006716660.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Defb3/Beta-defensin 3 ELISA Kit
E0392Mo 96 Tests

Mouse Defb3/Beta-defensin 3 ELISA Kit

Sign In for Pricing
View Details
JUP (Junction Plakoglobin, CTNNG, DP3, Catenin gamma, Desmoplakin III, Desmoplakin-3) (FITC)
MBS6383424-01 0.1 mL

JUP (Junction Plakoglobin, CTNNG, DP3, Catenin gamma, Desmoplakin III, Desmoplakin-3) (FITC)

Sign In for Pricing
View Details
JUP (Junction Plakoglobin, CTNNG, DP3, Catenin gamma, Desmoplakin III, Desmoplakin-3) (FITC)
MBS6383424-02 5x 0.1 mL

JUP (Junction Plakoglobin, CTNNG, DP3, Catenin gamma, Desmoplakin III, Desmoplakin-3) (FITC)

Sign In for Pricing
View Details
Sheep Iduronate-2-Sulfatase ELISA Kit
MBS106406-01 48 Well

Sheep Iduronate-2-Sulfatase ELISA Kit

Sign In for Pricing
View Details
Sheep Iduronate-2-Sulfatase ELISA Kit
MBS106406-02 96 Well

Sheep Iduronate-2-Sulfatase ELISA Kit

Sign In for Pricing
View Details
Sheep Iduronate-2-Sulfatase ELISA Kit
MBS106406-03 5x 96 Well

Sheep Iduronate-2-Sulfatase ELISA Kit

Sign In for Pricing
View Details