Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XKR8 Rabbit Polyclonal Antibody (Biotin)

XKR8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

XRG8, hXkr8

UniProt

Q9H6D3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human XKR8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CWKPDPDQVDGARSLLSPEGYQLPQNRRMTHLAQKFFPKAKDEAASPVKG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_060523

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SURF1 (Surfeit 1) discontinued
219260-01 20 µL

SURF1 (Surfeit 1) discontinued

Sign In for Pricing
View Details
SURF1 (Surfeit 1) discontinued
219260-02 100 µL

SURF1 (Surfeit 1) discontinued

Sign In for Pricing
View Details
Human FSH Beta HEK293 Overexpression Lysate
MBS8114831-01 0.3 mg

Human FSH Beta HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Human FSH Beta HEK293 Overexpression Lysate
MBS8114831-02 5x 0.3 mg

Human FSH Beta HEK293 Overexpression Lysate

Sign In for Pricing
View Details
ATP5H (ATP Synthase Subunit D, Mitochondrial, ATPase Subunit D, My032) APC
MBS6370706-01 0.1 mL

ATP5H (ATP Synthase Subunit D, Mitochondrial, ATPase Subunit D, My032) APC

Sign In for Pricing
View Details
ATP5H (ATP Synthase Subunit D, Mitochondrial, ATPase Subunit D, My032) APC
MBS6370706-02 5x 0.1 mL

ATP5H (ATP Synthase Subunit D, Mitochondrial, ATPase Subunit D, My032) APC

Sign In for Pricing
View Details