Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZDHHC20 Rabbit Polyclonal Antibody (HRP)

ZDHHC20 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DHHC20, DHHC-20, 4933421L13Rik

UniProt

B4DRN8

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ZDHHC20

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IFTSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSAS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001273567.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calgranulin B / MRP-8/-14 / MAC 387 / S100A8/A9 / Macrophage Ag (MAC387), CF640R conjugate, 0.1mg/mL
BNC400035-100 1x 100 µL

Calgranulin B / MRP-8/-14 / MAC 387 / S100A8/A9 / Macrophage Ag (MAC387), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant ANXA5 Antibody
RC-4361-01 50 μL

Recombinant ANXA5 Antibody

Sign In for Pricing
View Details
Recombinant ANXA5 Antibody
RC-4361-02 100 µL

Recombinant ANXA5 Antibody

Sign In for Pricing
View Details
Recombinant ANXA5 Antibody
RC-4361-03 1 mL

Recombinant ANXA5 Antibody

Sign In for Pricing
View Details
VPS37A Human qPCR Primer Pair (NM_152415)
HP217682 200 Reactions

VPS37A Human qPCR Primer Pair (NM_152415)

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF640R conjugate, 0.1mg/mL
BNC402337-100 1x 100 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details