Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZDHHC22 Rabbit Polyclonal Antibody (Biotin)

ZDHHC22 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C14orf59

UniProt

Q8N966

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZDHHC22

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QTRHQVRKGVAVRARPWRKNLQEVFGKRWLLGLLVPMFNVGSESSKQQDK

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_777636

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSTB Rabbit pAb
E45R25321N-50 50 µL

CSTB Rabbit pAb

Sign In for Pricing
View Details
CST4 Rabbit Polyclonal Antibody
E10G01060 100 µL

CST4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human T cell receptor interacting molecule, TRIM ELISA KIT
E4032hu-01 48 Well

Human T cell receptor interacting molecule, TRIM ELISA KIT

Sign In for Pricing
View Details
Human T cell receptor interacting molecule, TRIM ELISA KIT
E4032hu-02 96 Well

Human T cell receptor interacting molecule, TRIM ELISA KIT

Sign In for Pricing
View Details
Human T cell receptor interacting molecule, TRIM ELISA KIT
E4032hu-03 5x 96 Tests

Human T cell receptor interacting molecule, TRIM ELISA KIT

Sign In for Pricing
View Details
Human T cell receptor interacting molecule, TRIM ELISA KIT
E4032hu-04 10x 96 Tests

Human T cell receptor interacting molecule, TRIM ELISA KIT

Sign In for Pricing
View Details