Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF772 Rabbit Polyclonal Antibody (Biotin)

ZNF772 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q68DY9

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF772

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LAEHQETHPGQKPYMCVLCGKQFCFSANLHQHQKQHSGEKPFRSDKSRPF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001137540

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Noggin
AP60125 Inquire

Recombinant Human Noggin

Sign In for Pricing
View Details
12 Channel Reservoir Plate, 21ml channels, pyramid bottom, clear PP, 25 plates per case
4TI-0131 25/Box

12 Channel Reservoir Plate, 21ml channels, pyramid bottom, clear PP, 25 plates per case

Sign In for Pricing
View Details
Porcine Apoptosis Signal Regulating Kinase 1, ASK-1 ELISA Kit
MBS7260527-01 48 Well

Porcine Apoptosis Signal Regulating Kinase 1, ASK-1 ELISA Kit

Sign In for Pricing
View Details
Porcine Apoptosis Signal Regulating Kinase 1, ASK-1 ELISA Kit
MBS7260527-02 96 Well

Porcine Apoptosis Signal Regulating Kinase 1, ASK-1 ELISA Kit

Sign In for Pricing
View Details
Porcine Apoptosis Signal Regulating Kinase 1, ASK-1 ELISA Kit
MBS7260527-03 5x 96 Well

Porcine Apoptosis Signal Regulating Kinase 1, ASK-1 ELISA Kit

Sign In for Pricing
View Details
Porcine Apoptosis Signal Regulating Kinase 1, ASK-1 ELISA Kit
MBS7260527-04 10x 96 Well

Porcine Apoptosis Signal Regulating Kinase 1, ASK-1 ELISA Kit

Sign In for Pricing
View Details