Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC35E2B Rabbit Polyclonal Antibody (Biotin)

SLC35E2B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SLC35E2

UniProt

P0CK96

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC35E2B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SVKTPALEELVPGSEEKPKGRSPLSWGSLFGHRSEKIVFAKSDGGTDENV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_001104251

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGAP4 (ARHGAP 4, C1, KIAA0131, p115, Rho-GAP Hematopoietic Protein C1, RGC1, Rho GTPase-activating Protein 4, RhoGAP 4, RhoGAP4) (MaxLight 550)
MBS6210259-01 0.1 mL

ARHGAP4 (ARHGAP 4, C1, KIAA0131, p115, Rho-GAP Hematopoietic Protein C1, RGC1, Rho GTPase-activating Protein 4, RhoGAP 4, RhoGAP4) (MaxLight 550)

Sign In for Pricing
View Details
ARHGAP4 (ARHGAP 4, C1, KIAA0131, p115, Rho-GAP Hematopoietic Protein C1, RGC1, Rho GTPase-activating Protein 4, RhoGAP 4, RhoGAP4) (MaxLight 550)
MBS6210259-02 5x 0.1 mL

ARHGAP4 (ARHGAP 4, C1, KIAA0131, p115, Rho-GAP Hematopoietic Protein C1, RGC1, Rho GTPase-activating Protein 4, RhoGAP 4, RhoGAP4) (MaxLight 550)

Sign In for Pricing
View Details
Mouse Perinuclear anti-neutrophil cytoplasmic antibody (pANCA Ab) ELISA Kit
YP-W24001-01 48 Tests

Mouse Perinuclear anti-neutrophil cytoplasmic antibody (pANCA Ab) ELISA Kit

Sign In for Pricing
View Details
Mouse Perinuclear anti-neutrophil cytoplasmic antibody (pANCA Ab) ELISA Kit
YP-W24001-02 96 Tests

Mouse Perinuclear anti-neutrophil cytoplasmic antibody (pANCA Ab) ELISA Kit

Sign In for Pricing
View Details
ATP1B2, ID (ATP1B2, Sodium/potassium-transporting ATPase subunit beta-2, Sodium/potassium-dependent ATPase subunit beta-2)
032271 200 µL

ATP1B2, ID (ATP1B2, Sodium/potassium-transporting ATPase subunit beta-2, Sodium/potassium-dependent ATPase subunit beta-2)

Sign In for Pricing
View Details
Fosravuconazole L-lysine ethanolate
MBS3614560-01 2 mg

Fosravuconazole L-lysine ethanolate

Sign In for Pricing
View Details