Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL24 Rabbit Polyclonal Antibody (FITC)

METTL24 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C6orf186

UniProt

Q5JXM2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human METTL24

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SAPPGPAWRPPGPHLPPAPGQPRGASRRQVTYVRSGRRAPPGGGGSGTPE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001116836

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REV1 (NM_001037872) Human Tagged ORF Clone Lentiviral Particle
RC217528L4V 200 µL

REV1 (NM_001037872) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mucin 1 (MUC1 Glycoprotein, MUC-1, Breast Carcinoma Associated Antigen DF3, CA 15-3, Carcinoma Associated Mucin, CD227, DF3, EMA, Episialin, Epithelial Basement Membrane Antigen, Epithelial Membrane Antigen, Epithelial Mucin Tandem Repeat Sequence, H23 Antigen, H23AG, HGNC:7508, MAM6, Mucin 1 Precursor, Mucin 1 Transmembrane, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM, PEMT, Tumor Associated Epithelial Membrane Antigen, Tumor Associated Mucin) (MaxLight 650)
M4700-06J-ML650 100 µL

Mucin 1 (MUC1 Glycoprotein, MUC-1, Breast Carcinoma Associated Antigen DF3, CA 15-3, Carcinoma Associated Mucin, CD227, DF3, EMA, Episialin, Epithelial Basement Membrane Antigen, Epithelial Membrane Antigen, Epithelial Mucin Tandem Repeat Sequence, H23 Antigen, H23AG, HGNC:7508, MAM6, Mucin 1 Precursor, Mucin 1 Transmembrane, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM, PEMT, Tumor Associated Epithelial Membrane Antigen, Tumor Associated Mucin) (MaxLight 650)

Sign In for Pricing
View Details
EIF3H Protein Vector (Mouse) (pPB-C-His)
PV175054 500 ng

EIF3H Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Gpihbp1 Mouse qPCR Template Standard (NM_026730)
MK204187 1 Kit

Gpihbp1 Mouse qPCR Template Standard (NM_026730)

Sign In for Pricing
View Details
LRP6 shRNA (m) Lentiviral Particles
sc-37234-V 200 µL

LRP6 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Rabbit Anti-AMD1/SAMDC antibody
SL1887R-01 50 µL

Rabbit Anti-AMD1/SAMDC antibody

Sign In for Pricing
View Details