Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL24 Rabbit Polyclonal Antibody (Biotin)

METTL24 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C6orf186

UniProt

Q5JXM2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human METTL24

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EWKVLENLILEDVLEQIGQLIFEIHLHWPGFEVSGSDSSVVRFWYSLLKE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001116836

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYH14 antibody
70R-18703 50 μL

MYH14 antibody

Sign In for Pricing
View Details
SERPINH1, ID (Serpin H1, Collagen-binding Protein, Colligin, 47kD Heat Shock Protein, Rheumatoid Arthritis-related Antigen RA-A47, Arsenic-transactivated Protein 3, AsTP3, Cell Proliferation-inducing Gene 14 Protein, PIG14, SERPINH2, HSP47, CBP2, CBP1) (A
MBS6499012-01 0.2 mL

SERPINH1, ID (Serpin H1, Collagen-binding Protein, Colligin, 47kD Heat Shock Protein, Rheumatoid Arthritis-related Antigen RA-A47, Arsenic-transactivated Protein 3, AsTP3, Cell Proliferation-inducing Gene 14 Protein, PIG14, SERPINH2, HSP47, CBP2, CBP1) (A

Sign In for Pricing
View Details
SERPINH1, ID (Serpin H1, Collagen-binding Protein, Colligin, 47kD Heat Shock Protein, Rheumatoid Arthritis-related Antigen RA-A47, Arsenic-transactivated Protein 3, AsTP3, Cell Proliferation-inducing Gene 14 Protein, PIG14, SERPINH2, HSP47, CBP2, CBP1) (A
MBS6499012-02 5x 0.2 mL

SERPINH1, ID (Serpin H1, Collagen-binding Protein, Colligin, 47kD Heat Shock Protein, Rheumatoid Arthritis-related Antigen RA-A47, Arsenic-transactivated Protein 3, AsTP3, Cell Proliferation-inducing Gene 14 Protein, PIG14, SERPINH2, HSP47, CBP2, CBP1) (A

Sign In for Pricing
View Details
WDFY3 Rabbit pAb, Pacific Blue conjugated
orb2857648 100 µL

WDFY3 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
RN 1 dihydrochloride
256465-01 10 mg

RN 1 dihydrochloride

Sign In for Pricing
View Details
RN 1 dihydrochloride
256465-02 50 mg

RN 1 dihydrochloride

Sign In for Pricing
View Details