Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC85C Rabbit Polyclonal Antibody (HRP)

CCDC85C Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A6NKD9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CCDC85C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCNVVWRKLGDAASSK

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001138467

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit F-box only protein 41 (FBXO41) ELISA Kit
MBS7201823-01 48 Well

Rabbit F-box only protein 41 (FBXO41) ELISA Kit

Sign In for Pricing
View Details
Rabbit F-box only protein 41 (FBXO41) ELISA Kit
MBS7201823-02 96 Well

Rabbit F-box only protein 41 (FBXO41) ELISA Kit

Sign In for Pricing
View Details
Rabbit F-box only protein 41 (FBXO41) ELISA Kit
MBS7201823-03 5x 96 Well

Rabbit F-box only protein 41 (FBXO41) ELISA Kit

Sign In for Pricing
View Details
Rabbit F-box only protein 41 (FBXO41) ELISA Kit
MBS7201823-04 10x 96 Well

Rabbit F-box only protein 41 (FBXO41) ELISA Kit

Sign In for Pricing
View Details
EXOSC1 Antibody (YA8096, Mouse)
HY-P88412 1 Each

EXOSC1 Antibody (YA8096, Mouse)

Sign In for Pricing
View Details
Tear-off 4-tube Mat, 0,2 ml, RP
B31271 20 Mats/Box (480 Strips)

Tear-off 4-tube Mat, 0,2 ml, RP

Sign In for Pricing
View Details