Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM47E Rabbit Polyclonal Antibody (FITC)

FAM47E Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6ZV65

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM47E

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RYGAWYLNPKLWKKQRVDEPLVDPEVSHKAQEENFKKELQEQSIFKKAMD

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001229868

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HA Recombinant Protein
OPCA03539-1MG 1 mg

HA Recombinant Protein

Sign In for Pricing
View Details
Neurobeachin Rabbit Polyclonal Antibody (APC)
orb995381 100 µL

Neurobeachin Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Human Probable G-protein coupled receptor 144, GPR144 ELISA KIT
ELI-48031h 96 Tests

Human Probable G-protein coupled receptor 144, GPR144 ELISA KIT

Sign In for Pricing
View Details
Sphingomyelin Synthase 1 Rabbit Polyclonal Antibody (BF555)
orb2421081 100 µL

Sphingomyelin Synthase 1 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
MINIPIC 241-10X10 Facility & Office Signs & Labels (Adhesive)
257595 96 Sheet (96 Panel (s) x 1 Sheet)

MINIPIC 241-10X10 Facility & Office Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Lentiviral mouse Hid1 shRNA (UAS) - Lentiviral mouse Hid1 shRNA (UAS, iRFP) (25)
GTR15200246 1 Vial

Lentiviral mouse Hid1 shRNA (UAS) - Lentiviral mouse Hid1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details