Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM47E Rabbit Polyclonal Antibody (FITC)

FAM47E Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6ZV65

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM47E

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RYGAWYLNPKLWKKQRVDEPLVDPEVSHKAQEENFKKELQEQSIFKKAMD

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001229868

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-U6-PPP1R14B-shRNA2-EGFP-Puro Plasmid
PVT76351 2 µg

PLV3-U6-PPP1R14B-shRNA2-EGFP-Puro Plasmid

Sign In for Pricing
View Details
Lentiviral human RHBDD3 shRNA (UAS) - Lentiviral human RHBDD3 shRNA (UAS, GFP) (25)
GTR15145448 1 Vial

Lentiviral human RHBDD3 shRNA (UAS) - Lentiviral human RHBDD3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
PIC M014-Dia 315-PP-CRD/1 Personal Protection (PPE) Signs (No Adhesive)
819916 1 Card (1 Panel (s) x 1 Pack)

PIC M014-Dia 315-PP-CRD/1 Personal Protection (PPE) Signs (No Adhesive)

Sign In for Pricing
View Details
IFluor® 488 Anti-human/ non-human primates CD184 Antibody *12G5*
11840050-AAT 100 Tests

IFluor® 488 Anti-human/ non-human primates CD184 Antibody *12G5*

Sign In for Pricing
View Details
Human Pleckstrin (PLEK) ELISA Kit
EKU11794 96 Tests

Human Pleckstrin (PLEK) ELISA Kit

Sign In for Pricing
View Details
Anxa8 (NM_001031654) Rat Tagged Lenti ORF Clone
RR202870L3 10 µg

Anxa8 (NM_001031654) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details