Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM47E Rabbit Polyclonal Antibody (HRP)

FAM47E Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6ZV65

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human FAM47E

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KLEDTWAYCQDTRKGMKEPTKLLKKHSTQVYLGPSKKTSVSNAGQWLYEE

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant African swine fever virus Transmembrane protein EP84R (Mal-062), partial
MBS7059176 Inquire

Recombinant African swine fever virus Transmembrane protein EP84R (Mal-062), partial

Sign In for Pricing
View Details
IL1R2 Rabbit pAb
E45R29924N 50 ul

IL1R2 Rabbit pAb

Sign In for Pricing
View Details
TNNI3K Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-9458R-BF594 100 µL

TNNI3K Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Recombinant Neurospora crassa Glycylpeptide N-tetradecanoyltransferase (nmt-1), partial
MBS1475443 Inquire

Recombinant Neurospora crassa Glycylpeptide N-tetradecanoyltransferase (nmt-1), partial

Sign In for Pricing
View Details
Frozen Tissue Blocks, Metastasis, unknown source
CB617846 1 Block

Frozen Tissue Blocks, Metastasis, unknown source

Sign In for Pricing
View Details
LOC502618 (NM_001037366) Rat Tagged ORF Clone Lentiviral Particle
RR211218L4V 200 µL

LOC502618 (NM_001037366) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details