Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR89A Rabbit Polyclonal Antibody (FITC)

GPR89A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GPHR, GPR89, SH120, GPR89B, UNQ192

UniProt

B7ZAQ6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPR89A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EYRTIITEVLGELQFNFYHRWFDVIFLVSALSSILFLYLAHKQAPEKQMA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-EMC7 Antibody, Affinity Purified
MBS3905791-01 0.01 mg

Rabbit anti-EMC7 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-EMC7 Antibody, Affinity Purified
MBS3905791-02 0.1 mg

Rabbit anti-EMC7 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-EMC7 Antibody, Affinity Purified
MBS3905791-03 5x 0.01 mg

Rabbit anti-EMC7 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-EMC7 Antibody, Affinity Purified
MBS3905791-04 5x 0.1 mg

Rabbit anti-EMC7 Antibody, Affinity Purified

Sign In for Pricing
View Details
1500001M20Rik 3'UTR Luciferase Stable Cell Line
TU100090 1.0 mL

1500001M20Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SPATA20 Protein Vector (Rat) (pPM-C-His)
PV307553 500 ng

SPATA20 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details