Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGLC7 Rabbit Polyclonal Antibody (HRP)

IGLC7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A0M8Q6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IGLC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKT

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human MRPL18 shRNA (UAS) - Lentiviral human MRPL18 shRNA (UAS, RFP) (100)
GTR15348243 1 Vial

Lentiviral human MRPL18 shRNA (UAS) - Lentiviral human MRPL18 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
NAT9 Human Over-expression Lysate
orb1368908 20 µg

NAT9 Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Or5b99 qPCR Primer Pair
QM66746S 200 Tests

Mouse Or5b99 qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP phosphoribosyltransferase (hisG)
MBS1390708-01 0.02 mg (E-Coli)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP phosphoribosyltransferase (hisG)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP phosphoribosyltransferase (hisG)
MBS1390708-02 0.1 mg (E-Coli)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP phosphoribosyltransferase (hisG)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP phosphoribosyltransferase (hisG)
MBS1390708-03 0.02 mg (Yeast)

Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATP phosphoribosyltransferase (hisG)

Sign In for Pricing
View Details