Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGLC7 Rabbit Polyclonal Antibody (HRP)

IGLC7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A0M8Q6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IGLC1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKT

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Receptor I for the Fc region of immunoglobulin A, FcalphaR I ELISA Kit
OM617310 96 Strip Well

Bovine Receptor I for the Fc region of immunoglobulin A, FcalphaR I ELISA Kit

Sign In for Pricing
View Details
HER4 / ErbB4 Antibody
orb621172-01 50 μL

HER4 / ErbB4 Antibody

Sign In for Pricing
View Details
HER4 / ErbB4 Antibody
orb621172-02 100 µL

HER4 / ErbB4 Antibody

Sign In for Pricing
View Details
Methyl 2-amino-2- (thiophen-3-yl) acetate hydrochloride
HEA35702-01 50 mg

Methyl 2-amino-2- (thiophen-3-yl) acetate hydrochloride

Sign In for Pricing
View Details
Methyl 2-amino-2- (thiophen-3-yl) acetate hydrochloride
HEA35702-02 0.5 g

Methyl 2-amino-2- (thiophen-3-yl) acetate hydrochloride

Sign In for Pricing
View Details
PSTPIP1 Protein Vector (Rat) (pPB-C-His)
PV296986 500 ng

PSTPIP1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details