Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NBPF3 Rabbit Polyclonal Antibody (HRP)

NBPF3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AE2

UniProt

Q9H094

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NBPF3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CDQVKKEDQEATSPRLSRELLDEKEPEVLQDSLDRFYSTPFEYLELPDLC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3RF2, ID (SH3RF2, PPP1R39, RNF158, Putative E3 ubiquitin-protein ligase SH3RF2, Heart protein phosphatase 1-binding protein, Protein phosphatase 1 regulatory subunit 39, RING finger protein 158, SH3 domain-containing RING finger protein 2) (Azide free) (HRP) discontinued
041696-HRP 200 µL

SH3RF2, ID (SH3RF2, PPP1R39, RNF158, Putative E3 ubiquitin-protein ligase SH3RF2, Heart protein phosphatase 1-binding protein, Protein phosphatase 1 regulatory subunit 39, RING finger protein 158, SH3 domain-containing RING finger protein 2) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Cd164 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
15475116 3x 1.0 µg

Cd164 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
HIBCH Polyclonal Antibody
orb1419615 100 µL

HIBCH Polyclonal Antibody

Sign In for Pricing
View Details
Glycogen phosphorylase, liver form Polyclonal Antibody
orb359622 100 µg

Glycogen phosphorylase, liver form Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal B7-H2/ICOSLG Antibody (MM0103-19G23) [Alexa Fluor 700]
NBP2-12047AF700 0.1 mL

Mouse Monoclonal B7-H2/ICOSLG Antibody (MM0103-19G23) [Alexa Fluor 700]

Sign In for Pricing
View Details
Thyroglobulin Antibody Cocktail
V2264IHC-7ML 7 mL

Thyroglobulin Antibody Cocktail

Sign In for Pricing
View Details