Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEURL1B Rabbit Polyclonal Antibody (FITC)

NEURL1B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Neur2, NEURL3, RNF67B, hNeur2

UniProt

A8MQ27

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human NEURL1B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GQLRLLGTLQSSPATTTPSGSLSGSQDDSDSDMTFSVNQSSSASESSLVT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Guinea Pig IgG H&L Secondary Antibody-HRP
TMAB-02039H-01 100 µL

Mouse Anti-Guinea Pig IgG H&L Secondary Antibody-HRP

Sign In for Pricing
View Details
Mouse Anti-Guinea Pig IgG H&L Secondary Antibody-HRP
TMAB-02039H-02 1 mL

Mouse Anti-Guinea Pig IgG H&L Secondary Antibody-HRP

Sign In for Pricing
View Details
Comb Prep 2, Marker 2, 0.75 mm thick
ME20-2-0.75 1 Unit

Comb Prep 2, Marker 2, 0.75 mm thick

Sign In for Pricing
View Details
Lentiviral mouse Rcan1 shRNA (UAS) - Lentiviral mouse Rcan1 shRNA (UAS, RFP) (25)
GTR15202067 1 Vial

Lentiviral mouse Rcan1 shRNA (UAS) - Lentiviral mouse Rcan1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Tris (benzyltriazolylmethyl) amine
C03556-50mg 50 mg

Tris (benzyltriazolylmethyl) amine

Sign In for Pricing
View Details
ZNF847P Recombinant Protein (Human)
RP109337 100 µg

ZNF847P Recombinant Protein (Human)

Sign In for Pricing
View Details