Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PABPC1L Rabbit Polyclonal Antibody (FITC)

PABPC1L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EPAB, PABPC1L1, C20orf119, dJ1069P2.3

UniProt

Q4VY17

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human PABPC1L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GHSRCFGFVNFEKHEEAQKAVVHMNGKEVSGRLLYAGRAQKRVERQNELK

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001118228.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse 1700020A23Rik shRNA (UAS) - Lentiviral mouse 1700020A23Rik shRNA (UAS) (100)
GTR15270594 1 Vial

Lentiviral mouse 1700020A23Rik shRNA (UAS) - Lentiviral mouse 1700020A23Rik shRNA (UAS) (100)

Sign In for Pricing
View Details
Mouse Protein FAM116A, FAM116A ELISA Kit
MBS9339060-01 48 Well

Mouse Protein FAM116A, FAM116A ELISA Kit

Sign In for Pricing
View Details
Mouse Protein FAM116A, FAM116A ELISA Kit
MBS9339060-02 96 Well

Mouse Protein FAM116A, FAM116A ELISA Kit

Sign In for Pricing
View Details
Mouse Protein FAM116A, FAM116A ELISA Kit
MBS9339060-03 5x 96 Well

Mouse Protein FAM116A, FAM116A ELISA Kit

Sign In for Pricing
View Details
Mouse Protein FAM116A, FAM116A ELISA Kit
MBS9339060-04 10x 96 Well

Mouse Protein FAM116A, FAM116A ELISA Kit

Sign In for Pricing
View Details
Recombinant Mouse Putative small proline-rich protein 2J (Sprr2j)
MBS1051893-01 0.02 mg (E-Coli)

Recombinant Mouse Putative small proline-rich protein 2J (Sprr2j)

Sign In for Pricing
View Details