Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFX8 Rabbit Polyclonal Antibody (HRP)

RFX8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6ZV50

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RFX8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AIINQGTLATSKKALASDRSGADELENNPEMKCLRNLISLLGTSTDLRVF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LY6D Rabbit Polyclonal Antibody (HRP)
orb2581791 100 µg

LY6D Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
CCDC92 CRISPR Activation Plasmid (m)
sc-432027-ACT 20 µg

CCDC92 CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Gamma globulin, human
GE4986-250mg 250 mg

Gamma globulin, human

Sign In for Pricing
View Details
ELISA Kit for Activin A Receptor Type II B (ACVR2B)
TRV-0062910-01 24 Tests

ELISA Kit for Activin A Receptor Type II B (ACVR2B)

Sign In for Pricing
View Details
ELISA Kit for Activin A Receptor Type II B (ACVR2B)
TRV-0062910-02 48 Tests

ELISA Kit for Activin A Receptor Type II B (ACVR2B)

Sign In for Pricing
View Details
ELISA Kit for Activin A Receptor Type II B (ACVR2B)
TRV-0062910-03 96 Tests

ELISA Kit for Activin A Receptor Type II B (ACVR2B)

Sign In for Pricing
View Details