Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF90 Rabbit Polyclonal Antibody (HRP)

ZNF90 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HTF9

UniProt

Q03938

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZNF90

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CQECDKVFKRSSALSTHKIIHSGEKPYKCEECGKAFKRSSNLTTHKISHT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_009069

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transcobalamin 1 (Transcobalamin-1, TCN1, TC I, Haptocorrin, TC-1, Transcobalamin I, TC I, TCI) (HRP)
MBS6397076-01 0.1 mL

Transcobalamin 1 (Transcobalamin-1, TCN1, TC I, Haptocorrin, TC-1, Transcobalamin I, TC I, TCI) (HRP)

Sign In for Pricing
View Details
Transcobalamin 1 (Transcobalamin-1, TCN1, TC I, Haptocorrin, TC-1, Transcobalamin I, TC I, TCI) (HRP)
MBS6397076-02 5x 0.1 mL

Transcobalamin 1 (Transcobalamin-1, TCN1, TC I, Haptocorrin, TC-1, Transcobalamin I, TC I, TCI) (HRP)

Sign In for Pricing
View Details
Platelet-derived Growth Factor D, ID (SCDGFB, PDGF-D, Iris-expressed Growth Factor, Spinal Cord-derived Growth Factor B, SCDGF-B, Pdgfd, Iegf) (MaxLight 405) discontinued
P4258-98-ML405 100 µL

Platelet-derived Growth Factor D, ID (SCDGFB, PDGF-D, Iris-expressed Growth Factor, Spinal Cord-derived Growth Factor B, SCDGF-B, Pdgfd, Iegf) (MaxLight 405) discontinued

Sign In for Pricing
View Details
MSX1 (msh Homeobox 1, HOX7, HYD1) (HRP)
MBS6180277-01 0.1 mL

MSX1 (msh Homeobox 1, HOX7, HYD1) (HRP)

Sign In for Pricing
View Details
MSX1 (msh Homeobox 1, HOX7, HYD1) (HRP)
MBS6180277-02 5x 0.1 mL

MSX1 (msh Homeobox 1, HOX7, HYD1) (HRP)

Sign In for Pricing
View Details
PE Anti-Mouse CD86 Antibody
JOT20103F 50Tests

PE Anti-Mouse CD86 Antibody

Sign In for Pricing
View Details