Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF726 Rabbit Polyclonal Antibody (HRP)

ZNF726 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF92P3

UniProt

A6NNF4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ZNF726

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLSHKTQHKSIYTREKSYKCKKCGKTFNWSSILTNNKKIHTEQKPYKCEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_001230967.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti-Mouse CD11b-PE
1560-09L 0.2 mg

Rat Anti-Mouse CD11b-PE

Sign In for Pricing
View Details
FAR1 Rabbit pAb, Pacific Blue conjugated
orb2885188 100 µL

FAR1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
BCAR1 Colorimetric Cell-Based ELISA Kit
EKC1054 1 Kit, containing one 96 Well Plate and all necessary reagents

BCAR1 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
YAP, CT (65kD Yes-associated Protein, YAP 65, YAP65, YAP-65, Yes Associated Protein 1 65kDa, Yes-associated Protein 1, YAp 1, YAP1, YAP2) (Biotin) discontinued
Y1200-01F-Biotin 200 µL

YAP, CT (65kD Yes-associated Protein, YAP 65, YAP65, YAP-65, Yes Associated Protein 1 65kDa, Yes-associated Protein 1, YAp 1, YAP1, YAP2) (Biotin) discontinued

Sign In for Pricing
View Details
Bovine Long-chain-fatty-acid--CoA ligase ACSBG1, ACSBG1 ELISA Kit
MBS9331524-01 48 Well

Bovine Long-chain-fatty-acid--CoA ligase ACSBG1, ACSBG1 ELISA Kit

Sign In for Pricing
View Details
Bovine Long-chain-fatty-acid--CoA ligase ACSBG1, ACSBG1 ELISA Kit
MBS9331524-02 96 Well

Bovine Long-chain-fatty-acid--CoA ligase ACSBG1, ACSBG1 ELISA Kit

Sign In for Pricing
View Details