Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKN2A, Human

CDKN2A Protein, a potent negative regulator of cell proliferation, forms strong interactions with CDK4 and CDK6, hindering their association with cyclins D and retinoblastoma protein phosphorylation. Acting in a heterodimeric manner, predominantly with CDK6, CDKN2A inhibits cyclin D-CDK4 kinase activity and interacts with ISCO2, contributing to its cell cycle regulatory role. CDKN2A Protein, Human is the recombinant human-derived CDKN2A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CDKN2A Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cdkn2a-p16ink4a-protein-human.html

Purity

99.00

Smiles

EPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Molecular Formula

1029 (Gene_ID) P42771 (E2-D156) (Accession)

Molecular Weight

Approximately 19.12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL1A Recombinant Protein (Human)
OPCA00656-100UG 100 µg

IL1A Recombinant Protein (Human)

Sign In for Pricing
View Details
Fscn2 (NM_001107072) Rat Tagged Lenti ORF Clone
RR206219L4 10 µg

Fscn2 (NM_001107072) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ELOVL7 Double Nickase Plasmid (h)
sc-418315-NIC 20 µg

ELOVL7 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
WBP4 CRISPRa sgRNA lentivector (set of three targets)(Human)
50278121 3x 1.0µg DNA

WBP4 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Mouse Monoclonal FSHR Antibody (626717) [DyLight 594]
FAB65591M 0.5 mL

Mouse Monoclonal FSHR Antibody (626717) [DyLight 594]

Sign In for Pricing
View Details
PIRC114 Protein Vector (Human) (pPM-C-HA)
PV111180 500 ng

PIRC114 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details