Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKN2A, Human

CDKN2A Protein, a potent negative regulator of cell proliferation, forms strong interactions with CDK4 and CDK6, hindering their association with cyclins D and retinoblastoma protein phosphorylation. Acting in a heterodimeric manner, predominantly with CDK6, CDKN2A inhibits cyclin D-CDK4 kinase activity and interacts with ISCO2, contributing to its cell cycle regulatory role. CDKN2A Protein, Human is the recombinant human-derived CDKN2A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CDKN2A Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cdkn2a-p16ink4a-protein-human.html

Purity

99.00

Smiles

EPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Molecular Formula

1029 (Gene_ID) P42771 (E2-D156) (Accession)

Molecular Weight

Approximately 19.12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MS4A12 (NM_017716) Human Tagged ORF Clone Lentiviral Particle
RC206473L3V 200 µL

MS4A12 (NM_017716) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Mthfs (BC024567) Mouse Tagged ORF Clone Lentiviral Particle
MR200973L3V 200 µL

Mthfs (BC024567) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Disposable macro spoon/spatula, 310 mm long, green 150/pack
9101-7241 150/Pack

Disposable macro spoon/spatula, 310 mm long, green 150/pack

Ask
View Details
RNF213 (E3 Ubiquitin-protein Ligase RNF213, ALK Lymphoma Oligomerization Partner on Chromosome 17, Mysterin, RING Finger Protein 213, ALO17, C17orf27, KIAA1554, KIAA1618, MYSTR, MGC46622, MGC9929) (MaxLight 750)
MBS6231835-01 0.1 mL

RNF213 (E3 Ubiquitin-protein Ligase RNF213, ALK Lymphoma Oligomerization Partner on Chromosome 17, Mysterin, RING Finger Protein 213, ALO17, C17orf27, KIAA1554, KIAA1618, MYSTR, MGC46622, MGC9929) (MaxLight 750)

Ask
View Details
RNF213 (E3 Ubiquitin-protein Ligase RNF213, ALK Lymphoma Oligomerization Partner on Chromosome 17, Mysterin, RING Finger Protein 213, ALO17, C17orf27, KIAA1554, KIAA1618, MYSTR, MGC46622, MGC9929) (MaxLight 750)
MBS6231835-02 5x 0.1 mL

RNF213 (E3 Ubiquitin-protein Ligase RNF213, ALK Lymphoma Oligomerization Partner on Chromosome 17, Mysterin, RING Finger Protein 213, ALO17, C17orf27, KIAA1554, KIAA1618, MYSTR, MGC46622, MGC9929) (MaxLight 750)

Ask
View Details
Anti-Alpha-sarcoglycan antibody
PAab00342 100 µg

Anti-Alpha-sarcoglycan antibody

Ask
View Details