Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKN2A, Human

CDKN2A Protein, a potent negative regulator of cell proliferation, forms strong interactions with CDK4 and CDK6, hindering their association with cyclins D and retinoblastoma protein phosphorylation. Acting in a heterodimeric manner, predominantly with CDK6, CDKN2A inhibits cyclin D-CDK4 kinase activity and interacts with ISCO2, contributing to its cell cycle regulatory role. CDKN2A Protein, Human is the recombinant human-derived CDKN2A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CDKN2A Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cdkn2a-p16ink4a-protein-human.html

Purity

99.00

Smiles

EPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Molecular Formula

1029 (Gene_ID) P42771 (E2-D156) (Accession)

Molecular Weight

Approximately 19.12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human p53 up-regulated modulator of apoptosis (PUMA) ELISA Kit
201-12-1820 96 Tests

Human p53 up-regulated modulator of apoptosis (PUMA) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal CEACAM21 Antibody [mFluor Violet 500 SE]
NBP2-97874MFV500 0.1 mL

Rabbit Polyclonal CEACAM21 Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
ACIDESGRAS355X37CARD-T1-P21 Pipe Markers for Acids & Bases
N001898 3 Card (3 Marker (s) x 1 Card)

ACIDESGRAS355X37CARD-T1-P21 Pipe Markers for Acids & Bases

Sign In for Pricing
View Details
NFκB-p65 (Acetyl Lys122) Polyclonal Antibody
E20-40064 100 µg

NFκB-p65 (Acetyl Lys122) Polyclonal Antibody

Sign In for Pricing
View Details
Genorise® Biotinylated Mouse CCL2 Polyclonal Antibody
GR138025 50 mg

Genorise® Biotinylated Mouse CCL2 Polyclonal Antibody

Sign In for Pricing
View Details
JAB1
321240 100 µL

JAB1

Sign In for Pricing
View Details