Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZCCHC18 Rabbit Polyclonal Antibody (FITC)

ZCCHC18 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SIZN2, PNMA7B

UniProt

P0CG32

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZCCHC18

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SGGSGYKNDGPGNIRRARKRKYTTRCSYCGEEGHSKETCDNESNKAQVFE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001137450

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc Sulphate AR/ACS (Zinc sulphate-7-hydrate) Meets Analytical Specificationof IP, BP, USP, Ph. Eur. 99.5%
695835-01 25 Kg

Zinc Sulphate AR/ACS (Zinc sulphate-7-hydrate) Meets Analytical Specificationof IP, BP, USP, Ph. Eur. 99.5%

Sign In for Pricing
View Details
Zinc Sulphate AR/ACS (Zinc sulphate-7-hydrate) Meets Analytical Specificationof IP, BP, USP, Ph. Eur. 99.5%
695835-02 50 Kg

Zinc Sulphate AR/ACS (Zinc sulphate-7-hydrate) Meets Analytical Specificationof IP, BP, USP, Ph. Eur. 99.5%

Sign In for Pricing
View Details
Zinc Sulphate AR/ACS (Zinc sulphate-7-hydrate) Meets Analytical Specificationof IP, BP, USP, Ph. Eur. 99.5%
695835-03 500 g

Zinc Sulphate AR/ACS (Zinc sulphate-7-hydrate) Meets Analytical Specificationof IP, BP, USP, Ph. Eur. 99.5%

Sign In for Pricing
View Details
Zinc Sulphate AR/ACS (Zinc sulphate-7-hydrate) Meets Analytical Specificationof IP, BP, USP, Ph. Eur. 99.5%
695835-04 5 Kg

Zinc Sulphate AR/ACS (Zinc sulphate-7-hydrate) Meets Analytical Specificationof IP, BP, USP, Ph. Eur. 99.5%

Sign In for Pricing
View Details
UBA52 Rabbit Polyclonal Antibody
E10G12903 100 µL

UBA52 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PPP3R1 Protein Vector (Mouse) (pPB-C-His)
PV218758 500 ng

PPP3R1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details