Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB8B Rabbit Polyclonal Antibody (Biotin)

ZBTB8B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF916B

UniProt

Q8NAP8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZBTB8B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LVEASSESQEKSDTDNDWPIYVESGEENDPAGDDSDDKPQIQPNLSDRET

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001139192

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse EGF Like Domain Protein, Multiple 6 ELISA Kit
MBS095939-01 48 Well

Mouse EGF Like Domain Protein, Multiple 6 ELISA Kit

Sign In for Pricing
View Details
Mouse EGF Like Domain Protein, Multiple 6 ELISA Kit
MBS095939-02 96 Well

Mouse EGF Like Domain Protein, Multiple 6 ELISA Kit

Sign In for Pricing
View Details
Mouse EGF Like Domain Protein, Multiple 6 ELISA Kit
MBS095939-03 5x 96 Well

Mouse EGF Like Domain Protein, Multiple 6 ELISA Kit

Sign In for Pricing
View Details
Mouse EGF Like Domain Protein, Multiple 6 ELISA Kit
MBS095939-04 10x 96 Well

Mouse EGF Like Domain Protein, Multiple 6 ELISA Kit

Sign In for Pricing
View Details
Bovine CREB1/Cyclic AMP-responsive element-binding protein 1 ELISA Kit
orb1661847 96 Tests

Bovine CREB1/Cyclic AMP-responsive element-binding protein 1 ELISA Kit

Sign In for Pricing
View Details
3- (2- (Dimethylamino) ethylcarbamoyl) phenylboronic acid
422355-01 100 mg

3- (2- (Dimethylamino) ethylcarbamoyl) phenylboronic acid

Sign In for Pricing
View Details