Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB8B Rabbit Polyclonal Antibody (HRP)

ZBTB8B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF916B

UniProt

Q8NAP8

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZBTB8B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVEASSESQEKSDTDNDWPIYVESGEENDPAGDDSDDKPQIQPNLSDRET

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001139192

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC35E4 Rabbit Polyclonal Antibody (Biotin)
orb2590971 100 µg

SLC35E4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
TRIP15 (COPS2) (NM_004236) Human Untagged Clone
SC319732 10 µg

TRIP15 (COPS2) (NM_004236) Human Untagged Clone

Sign In for Pricing
View Details
MASP1/MASP3 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-1723R-BF750-TR 20 µL

MASP1/MASP3 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Mouse Programmed Cell Death Protein 1 Ligand 1 (PDCD1LG1) ELISA Kit
RD-PDCD1LG1-Mu-01 96 Tests

Mouse Programmed Cell Death Protein 1 Ligand 1 (PDCD1LG1) ELISA Kit

Sign In for Pricing
View Details
Mouse Programmed Cell Death Protein 1 Ligand 1 (PDCD1LG1) ELISA Kit
RD-PDCD1LG1-Mu-02 48 Tests

Mouse Programmed Cell Death Protein 1 Ligand 1 (PDCD1LG1) ELISA Kit

Sign In for Pricing
View Details
Human Endostatin (ES) ELISA Kit
YP-W11099-01 48 Tests

Human Endostatin (ES) ELISA Kit

Sign In for Pricing
View Details