Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM221 Rabbit Polyclonal Antibody (Biotin)

TMEM221 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

A6NGB7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMEM221

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RAARRGLHELSPPSFEDDLARPAEVSKASPRAQPQQGIHRRTPYSTCPEP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_001177773

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POU3F2 (POU Class 3 Homeobox 2, BRN2, OCT7, OTF7, POUF3) (MaxLight 750)
MBS6240015-01 0.1 mL

POU3F2 (POU Class 3 Homeobox 2, BRN2, OCT7, OTF7, POUF3) (MaxLight 750)

Sign In for Pricing
View Details
POU3F2 (POU Class 3 Homeobox 2, BRN2, OCT7, OTF7, POUF3) (MaxLight 750)
MBS6240015-02 5x 0.1 mL

POU3F2 (POU Class 3 Homeobox 2, BRN2, OCT7, OTF7, POUF3) (MaxLight 750)

Sign In for Pricing
View Details
Whatman Autovial 12 0.45um NS PSU - PK50
FIL2636 50 / PCK

Whatman Autovial 12 0.45um NS PSU - PK50

Sign In for Pricing
View Details
Recombinant Chironomus thummi thummi Globin CTT-VI (CTT-6)
MBS1178527-01 0.02 mg (E-Coli)

Recombinant Chironomus thummi thummi Globin CTT-VI (CTT-6)

Sign In for Pricing
View Details
Recombinant Chironomus thummi thummi Globin CTT-VI (CTT-6)
MBS1178527-02 0.1 mg (E-Coli)

Recombinant Chironomus thummi thummi Globin CTT-VI (CTT-6)

Sign In for Pricing
View Details
Recombinant Chironomus thummi thummi Globin CTT-VI (CTT-6)
MBS1178527-03 0.02 mg (Yeast)

Recombinant Chironomus thummi thummi Globin CTT-VI (CTT-6)

Sign In for Pricing
View Details