Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM221 Rabbit Polyclonal Antibody (HRP)

TMEM221 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A6NGB7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMEM221

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RAARRGLHELSPPSFEDDLARPAEVSKASPRAQPQQGIHRRTPYSTCPEP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_001177773

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Psmc3 / 26S protease regulatory subunit 6A Recombinant Protein
R12498m 1 Each

Mouse Psmc3 / 26S protease regulatory subunit 6A Recombinant Protein

Sign In for Pricing
View Details
Anti-B Raf/BRAF Antibody Picoband® Fluoro647 Conjugated
PA1848-Fluoro647 100 µg/Vial

Anti-B Raf/BRAF Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal PGBD1 Antibody
NBP1-85162 0.1 mL

Rabbit Polyclonal PGBD1 Antibody

Sign In for Pricing
View Details
Deuterium Chloride >99.0 Atom % D (38% in D2O) 10ml bottle
DE48-01 1 Pack

Deuterium Chloride >99.0 Atom % D (38% in D2O) 10ml bottle

Sign In for Pricing
View Details
Deuterium Chloride >99.0 Atom % D (38% in D2O) 10ml bottle
DE48-02 2 PCKS

Deuterium Chloride >99.0 Atom % D (38% in D2O) 10ml bottle

Sign In for Pricing
View Details
Deuterium Chloride >99.0 Atom % D (38% in D2O) 10ml bottle
DE48-03 5 Packs

Deuterium Chloride >99.0 Atom % D (38% in D2O) 10ml bottle

Sign In for Pricing
View Details