Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBX20 Rabbit Polyclonal Antibody (FITC)

TBX20 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ASD4

UniProt

Q9UMR3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBX20

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RLGMPLTPSAIASSMQGSGPTFPSFHMPRYHHYFQQGPYAAIQGLRHSSA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF2α (I45) polyclonal antibody
BS3651-01 50 µL

EIF2α (I45) polyclonal antibody

Sign In for Pricing
View Details
EIF2α (I45) polyclonal antibody
BS3651-02 100 µL

EIF2α (I45) polyclonal antibody

Sign In for Pricing
View Details
Actinin-α1/2/3/4 (W48) polyclonal antibody
E43S2206 100 µg

Actinin-α1/2/3/4 (W48) polyclonal antibody

Sign In for Pricing
View Details
ATG12 Polyclonal Antibody, APC Conjugated
bs-4012R-APC 100 µL

ATG12 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
SCRIB, NT (SCRIB, CRIB1, KIAA0147, LAP4, SCRB1, VARTUL, Protein scribble homolog, Protein LAP4) (AP)
MBS6345415-01 0.2 mL

SCRIB, NT (SCRIB, CRIB1, KIAA0147, LAP4, SCRB1, VARTUL, Protein scribble homolog, Protein LAP4) (AP)

Sign In for Pricing
View Details
SCRIB, NT (SCRIB, CRIB1, KIAA0147, LAP4, SCRB1, VARTUL, Protein scribble homolog, Protein LAP4) (AP)
MBS6345415-02 5x 0.2 mL

SCRIB, NT (SCRIB, CRIB1, KIAA0147, LAP4, SCRB1, VARTUL, Protein scribble homolog, Protein LAP4) (AP)

Sign In for Pricing
View Details