Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBX20 Rabbit Polyclonal Antibody (HRP)

TBX20 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ASD4

UniProt

Q9UMR3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBX20

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RLGMPLTPSAIASSMQGSGPTFPSFHMPRYHHYFQQGPYAAIQGLRHSSA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), 0.2mg/mL
BNUB2571-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/2571R), 0.2mg/mL

Sign In for Pricing
View Details
FUT3 (NM_001097640) Human Over-expression Lysate
LC420414 20 µg

FUT3 (NM_001097640) Human Over-expression Lysate

Sign In for Pricing
View Details
Ornithine Decarboxylase-1 (ODC-1) (rODC1/485), CF594 conjugate, 0.1mg/mL
BNC943439-500 1x 500 µL

Ornithine Decarboxylase-1 (ODC-1) (rODC1/485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MECR (NM_016011) Human Recombinant Protein
TP324634L 1 mg

MECR (NM_016011) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Fen1 activation kit by CRISPRa
GA201385 1 Kit

Mouse Fen1 activation kit by CRISPRa

Sign In for Pricing
View Details
HRP Conjugate Stock Stabilizer, 5X
667 100 mL

HRP Conjugate Stock Stabilizer, 5X

Sign In for Pricing
View Details