Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cacng1 Rabbit Polyclonal Antibody (Biotin)

Cacng1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

O70578

Immunogen

The immunogen for Anti-Cacng1 antibody is: synthetic peptide directed towards the C-terminal of Mouse CCG1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WIEHYYSWSFACACAAFILLFLGGLFLLLFSLPRMPQNPWESCMDAEPEH

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

NCBI Accession Number

NP_031608.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Irak2 Antibody (C-term) Blocking Peptide
MBS9221474-01 0.5 mg

Mouse Irak2 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
Mouse Irak2 Antibody (C-term) Blocking Peptide
MBS9221474-02 5x 0.5 mg

Mouse Irak2 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Kidney Injury Moleule 1 (Kim1)
MBS2144048-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Kidney Injury Moleule 1 (Kim1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Kidney Injury Moleule 1 (Kim1)
MBS2144048-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Kidney Injury Moleule 1 (Kim1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Kidney Injury Moleule 1 (Kim1)
MBS2144048-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Kidney Injury Moleule 1 (Kim1)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Kidney Injury Moleule 1 (Kim1)
MBS2144048-04 1 mL

Biotin-Linked Monoclonal Antibody to Kidney Injury Moleule 1 (Kim1)

Sign In for Pricing
View Details