Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRN3 Rabbit Polyclonal Antibody (HRP)

LRRN3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NLRR3, NLRR-3, FIGLER5

UniProt

Q9H3W5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human LRRN3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KNRKKCVNVTTKGLHPDQKEYEKNNTTTLMACLGGLLGIIGVICLISCLS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_060804

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1, phosphorylated (T1224) (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial
MBS6000039-01 0.2 mL

MUC1, phosphorylated (T1224) (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial

Sign In for Pricing
View Details
MUC1, phosphorylated (T1224) (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial
MBS6000039-02 5x 0.2 mL

MUC1, phosphorylated (T1224) (MUC1, PUM, Mucin-1, Breast carcinoma-associated antigen DF3, Carcinoma-associated mucin, Episialin, H23AG, Krebs von den Lungen-6, PEMT, Peanut-reactive urinary mucin, Polymorphic epithelial mucin, Tumor-associated epithelial

Sign In for Pricing
View Details
Lentiviral mouse Fbxw22 shRNA (UAS) - Lentiviral mouse Fbxw22 shRNA (UAS, iRFP) (25)
GTR15219734 1 Vial

Lentiviral mouse Fbxw22 shRNA (UAS) - Lentiviral mouse Fbxw22 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Rabbit Anti-Human ZNF200 pAb
PA8427-01 50 μL

Rabbit Anti-Human ZNF200 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human ZNF200 pAb
PA8427-02 100 μL

Rabbit Anti-Human ZNF200 pAb

Sign In for Pricing
View Details
IRF5P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV730076 1.0 µg DNA

IRF5P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details