Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD51 Rabbit Polyclonal Antibody (Biotin)

RAD51 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RECA, BRCC5, FANCR, MRMV2, HRAD51, RAD51A, HsRad51, HsT16930

UniProt

Q06609

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAD51

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DYSGRGELSARQMHLARFLRMLLRLADEIVSEERKRGNQNLQNLRLSLSS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pak1ip1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K5000307 1.0 µg DNA

Pak1ip1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Entpd3-set siRNA/shRNA/RNAi Lentivector (Rat)
19322096 4x 500 ng

Entpd3-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
N4BP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2786307 1.0 µg DNA

N4BP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
CHMP1A, NT (CHMP1A, CHMP1, KIAA0047, PCOLN3, PRSM1, Charged multivesicular body protein 1a, Chromatin-modifying protein 1a, Vacuolar protein sorting-associated protein 46-1) (Azide free) (HRP) discontinued
033850-HRP 200 µL

CHMP1A, NT (CHMP1A, CHMP1, KIAA0047, PCOLN3, PRSM1, Charged multivesicular body protein 1a, Chromatin-modifying protein 1a, Vacuolar protein sorting-associated protein 46-1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
CD99 Antibody (APC)
orb233585 100 Tests

CD99 Antibody (APC)

Sign In for Pricing
View Details
LILRB polyclonal antibody
BS60703-01 50 µL

LILRB polyclonal antibody

Sign In for Pricing
View Details