Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD51 Rabbit Polyclonal Antibody (HRP)

RAD51 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RECA, BRCC5, FANCR, MRMV2, HRAD51, RAD51A, HsRad51, HsT16930

UniProt

Q06609

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RAD51

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DYSGRGELSARQMHLARFLRMLLRLADEIVSEERKRGNQNLQNLRLSLSS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC3 (Mucin 3) (MUC3/2992R), CF647 conjugate, 0.1mg/mL
BNC472992-100 1x 100 µL

MUC3 (Mucin 3) (MUC3/2992R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rbm18 (NM_026434) Mouse Tagged ORF Clone
MG201803 10 µg

Rbm18 (NM_026434) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
INPP1 (NM_002194) Human Over-expression Lysate
LC419477 20 µg

INPP1 (NM_002194) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human Neuroligin 1/NLGN1 Protein (His Tag)
PKSH031062 100 µg

Recombinant Human Neuroligin 1/NLGN1 Protein (His Tag)

Sign In for Pricing
View Details
PDHA1 Human Gene Knockout Kit (CRISPR)
KN401831 1 Kit

PDHA1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SYTL2 (NM_032943) Human Recombinant Protein
TP317584M 100 µg

SYTL2 (NM_032943) Human Recombinant Protein

Sign In for Pricing
View Details