Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERCC8 Rabbit Polyclonal Antibody (HRP)

ERCC8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CSA, CKN1, UVSS2

UniProt

Q13216

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ERCC8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QSNFQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_000073

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NME1 (Nucleoside Diphosphate Kinase A, Granzyme A-activated DNase, AWD, GAAD, NB, NBS, NDPK-A, NDPKA, NM23, NM23-H1, NDKA) (Biotin)
MBS6429248-01 0.1 mL

NME1 (Nucleoside Diphosphate Kinase A, Granzyme A-activated DNase, AWD, GAAD, NB, NBS, NDPK-A, NDPKA, NM23, NM23-H1, NDKA) (Biotin)

Sign In for Pricing
View Details
NME1 (Nucleoside Diphosphate Kinase A, Granzyme A-activated DNase, AWD, GAAD, NB, NBS, NDPK-A, NDPKA, NM23, NM23-H1, NDKA) (Biotin)
MBS6429248-02 5x 0.1 mL

NME1 (Nucleoside Diphosphate Kinase A, Granzyme A-activated DNase, AWD, GAAD, NB, NBS, NDPK-A, NDPKA, NM23, NM23-H1, NDKA) (Biotin)

Sign In for Pricing
View Details
Rat Proline-, glutamic acid- and leucine-rich protein 1, PELP1 ELISA Kit
MBS9335299-01 48 Well

Rat Proline-, glutamic acid- and leucine-rich protein 1, PELP1 ELISA Kit

Sign In for Pricing
View Details
Rat Proline-, glutamic acid- and leucine-rich protein 1, PELP1 ELISA Kit
MBS9335299-02 96 Well

Rat Proline-, glutamic acid- and leucine-rich protein 1, PELP1 ELISA Kit

Sign In for Pricing
View Details
Rat Proline-, glutamic acid- and leucine-rich protein 1, PELP1 ELISA Kit
MBS9335299-03 5x 96 Well

Rat Proline-, glutamic acid- and leucine-rich protein 1, PELP1 ELISA Kit

Sign In for Pricing
View Details
Rat Proline-, glutamic acid- and leucine-rich protein 1, PELP1 ELISA Kit
MBS9335299-04 10x 96 Well

Rat Proline-, glutamic acid- and leucine-rich protein 1, PELP1 ELISA Kit

Sign In for Pricing
View Details