Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSS Rabbit Polyclonal Antibody (HRP)

GSS Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GSHS, HEL-S-64p, HEL-S-88n

UniProt

P48637

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GSS

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EEGDQAIAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERAS

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_005260463

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MAK Protein - (Dry Ice)
H00004117-P01-2ug 2 µg

Recombinant Human MAK Protein - (Dry Ice)

Sign In for Pricing
View Details
PHGDH (NM_006623) Human Recombinant Protein
TP303949M 100 µg

PHGDH (NM_006623) Human Recombinant Protein

Sign In for Pricing
View Details
SAM68 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62865R-BF350-01 20 µL

SAM68 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
SAM68 Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-62865R-BF350-02 100 µL

SAM68 Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Carbonic Anhydrase 2 (CA2) Antibody (Biotin)
abx273075-01 200 µL

Carbonic Anhydrase 2 (CA2) Antibody (Biotin)

Sign In for Pricing
View Details
Carbonic Anhydrase 2 (CA2) Antibody (Biotin)
abx273075-02 1 mL

Carbonic Anhydrase 2 (CA2) Antibody (Biotin)

Sign In for Pricing
View Details