Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAF1 Rabbit Polyclonal Antibody (HRP)

RAF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NS5, CRAF, Raf-1, c-Raf, CMD1NN

UniProt

B4E0X2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human RAF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_005265415

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RGPD5 knockout cell line
ABC-KH12895 1 Vial

Human RGPD5 knockout cell line

Sign In for Pricing
View Details
Col9a3 Rat siRNA Oligo Duplex (Locus ID 362285)
SR501217 1 Kit

Col9a3 Rat siRNA Oligo Duplex (Locus ID 362285)

Sign In for Pricing
View Details
TBX15 (h) -PR
sc-38477-PR 10 µM - 20 µL

TBX15 (h) -PR

Sign In for Pricing
View Details
E/E030/NT/FLO-500X500-1 Floor Signs
303759 1 Pack (1 Panel (s) x 1 Pack)

E/E030/NT/FLO-500X500-1 Floor Signs

Sign In for Pricing
View Details
Erbin (phospho Tyr1104) Polyclonal Antibody
ABP50308-01 30 µL

Erbin (phospho Tyr1104) Polyclonal Antibody

Sign In for Pricing
View Details
Erbin (phospho Tyr1104) Polyclonal Antibody
ABP50308-02 100 µL

Erbin (phospho Tyr1104) Polyclonal Antibody

Sign In for Pricing
View Details