Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNK Rabbit Polyclonal Antibody (HRP)

UNK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Unkh, Zc3h5, Zc3hdc5, mKIAA1753, B230379M23Rik

UniProt

Q8BL48

Immunogen

The immunogen is a synthetic peptide directed towards the Middle region of Mouse UNK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YVLGNYKTEPCKKPPRLCRQGYACPYYHNSKDRRRSPRKHKYRSSPCPNV

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

87 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FSH beta (FSHB) Monoclonal Antibody
M01885-1 100 µL/Vial

Anti-FSH beta (FSHB) Monoclonal Antibody

Sign In for Pricing
View Details
DNM1L (Dynamin 1-like, DLP1, DRP1, DVLP, DYMPLE, DYNIV-11, FLJ41912, HDYNIV, VPS1) (MaxLight 650)
245458-ML650 100 µL

DNM1L (Dynamin 1-like, DLP1, DRP1, DVLP, DYMPLE, DYNIV-11, FLJ41912, HDYNIV, VPS1) (MaxLight 650)

Sign In for Pricing
View Details
DPP10 Protein Vector (Rat) (pPM-C-His)
PV264793 500 ng

DPP10 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
ZMYM4 Antibody
MBS8509975-01 0.1 mg

ZMYM4 Antibody

Sign In for Pricing
View Details
ZMYM4 Antibody
MBS8509975-02 0.1 mL (AF635)

ZMYM4 Antibody

Sign In for Pricing
View Details
ZMYM4 Antibody
MBS8509975-03 0.1 mL (AF610)

ZMYM4 Antibody

Sign In for Pricing
View Details