Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNK Rabbit Polyclonal Antibody (HRP)

UNK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Unkh, Zc3h5, Zc3hdc5, mKIAA1753, B230379M23Rik

UniProt

Q8BL48

Immunogen

The immunogen is a synthetic peptide directed towards the Middle region of Mouse UNK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YVLGNYKTEPCKKPPRLCRQGYACPYYHNSKDRRRSPRKHKYRSSPCPNV

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

87 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Mouse

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTFE Stirring Rod Steel Core 250 x 6mm
STI4366 1 Each

PTFE Stirring Rod Steel Core 250 x 6mm

Sign In for Pricing
View Details
Kinesis Syringe CTC LC Autosampler 50ul 51mm 22G FN GT
CHR1549 1 Each

Kinesis Syringe CTC LC Autosampler 50ul 51mm 22G FN GT

Sign In for Pricing
View Details
Diatrizoic acid EP impurity A
HY-W153917 1 Each

Diatrizoic acid EP impurity A

Sign In for Pricing
View Details
Epha3 ORF Vector (Rat) (pORF)
ORF066584 1.0 µg DNA

Epha3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
PYGO2 Protein Vector (Mouse) (pPM-C-HA)
PV221404 500 ng

PYGO2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
LARP1 polyclonal antibody
BS71974-01 50 µL

LARP1 polyclonal antibody

Sign In for Pricing
View Details