Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HEBP1 Rabbit Polyclonal Antibody (HRP)

HEBP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HBP, HEBP

UniProt

Q9NRV9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human HEBP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GYAKEADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_057071

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SOX10 Antibody (SOX10/1074)
NBP2-59622-100ug 100 µg

Mouse Monoclonal SOX10 Antibody (SOX10/1074)

Sign In for Pricing
View Details
Mamdc4 (NM_001081199) Mouse Tagged ORF Clone Lentiviral Particle
MR225199L4V 200 µL

Mamdc4 (NM_001081199) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NE Purified anti-human CD11c
E16FHY011c-500U 500 µg

NE Purified anti-human CD11c

Sign In for Pricing
View Details
TIMP-1 Antibody
GWB-1B64A4 0.1 mg

TIMP-1 Antibody

Sign In for Pricing
View Details
Arl6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6546506 1.0 µg DNA

Arl6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Ku (p70/p80) (Ku (p70) : 70kD subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70kD subunit, CTC box-binding factor 75kD subunit, CTC75, CTCBF, DNA repair protein XRCC6, G22P1, Ku autoantigen, 70kD, Ku70, Kup70, Lupus Ku autoantigen protein p70, ML8, Thyroid autoantigen 70kD (Ku antigen), Thyroid-lupus autoantigen (TLAA), X-ray repair cross-complementing protein 6 (XRCC6) Ku (p80) : 86kD subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 2, ATP dependent DNA helicase II 86kD subunit, ATP-dependent DNA helicase II 80kD subunit, CTC box-binding factor 85kDa subunit, CTC85, CTCBF, DNA repair protein XRCC5, KARP1, Ku autoantigen 80kD, Ku80, Ku86 autoantigen related protein 1, KUB2, Lupus Ku autoantigen protein p86, Nuclear factor IV (NFIV), Thyroid-lupus autoantigen (TLAA), X-ray repair cross-complementing protein 5 (XRCC5) ) (PE)
168818-AF-PE 100 µL

Ku (p70/p80) (Ku (p70) : 70kD subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 1, ATP-dependent DNA helicase II 70kD subunit, CTC box-binding factor 75kD subunit, CTC75, CTCBF, DNA repair protein XRCC6, G22P1, Ku autoantigen, 70kD, Ku70, Kup70, Lupus Ku autoantigen protein p70, ML8, Thyroid autoantigen 70kD (Ku antigen), Thyroid-lupus autoantigen (TLAA), X-ray repair cross-complementing protein 6 (XRCC6) Ku (p80) : 86kD subunit of Ku antigen, ATP dependent DNA helicase 2 subunit 2, ATP dependent DNA helicase II 86kD subunit, ATP-dependent DNA helicase II 80kD subunit, CTC box-binding factor 85kDa subunit, CTC85, CTCBF, DNA repair protein XRCC5, KARP1, Ku autoantigen 80kD, Ku80, Ku86 autoantigen related protein 1, KUB2, Lupus Ku autoantigen protein p86, Nuclear factor IV (NFIV), Thyroid-lupus autoantigen (TLAA), X-ray repair cross-complementing protein 5 (XRCC5) ) (PE)

Sign In for Pricing
View Details