Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP100 Rabbit Polyclonal Antibody (Biotin)

SP100 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Lysp100b

UniProt

P23497

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human SP100

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IIVISSEDSEGSTDVDEPLEVFISAPRSEPVINNDNPLESNDEKEGQEAT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

96kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_003104

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMP22 (Peripheral Myelin Protein 22, PMP-22, Growth Arrest-specific Protein 3, GAS-3, GAS3) (MaxLight 490)
131518-ML490 100 µL

PMP22 (Peripheral Myelin Protein 22, PMP-22, Growth Arrest-specific Protein 3, GAS-3, GAS3) (MaxLight 490)

Sign In for Pricing
View Details
Mbtd1 (BC064014) Mouse Untagged Clone
MC205929 10 µg

Mbtd1 (BC064014) Mouse Untagged Clone

Sign In for Pricing
View Details
ACVRL1 (Activin A Receptor Type II-like 1, TGF-B Superfamily Receptor Type I, Activin A Receptor, Type II-like Kinase 1, Serine/Threonine-Protein Kinase Receptor R3, ACVRLK1, ALK-1, ALK1, HHT, HHT2, ORW2, SKR3, TSR-I) (PE)
207469-PE 100 µL

ACVRL1 (Activin A Receptor Type II-like 1, TGF-B Superfamily Receptor Type I, Activin A Receptor, Type II-like Kinase 1, Serine/Threonine-Protein Kinase Receptor R3, ACVRLK1, ALK-1, ALK1, HHT, HHT2, ORW2, SKR3, TSR-I) (PE)

Sign In for Pricing
View Details
Pacific Blue™ anti-human Siglec-9
GT12901 25 Tests

Pacific Blue™ anti-human Siglec-9

Sign In for Pricing
View Details
Goat Circadian locomoter output cycles protein kaput (CLOCK) ELISA kit
GTR10375530 96 Well

Goat Circadian locomoter output cycles protein kaput (CLOCK) ELISA kit

Sign In for Pricing
View Details
Rat Khdrbs3 ELISA Kit
ELI-39046r 96 Tests

Rat Khdrbs3 ELISA Kit

Sign In for Pricing
View Details