Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HOXB1 Rabbit Polyclonal Antibody (HRP)

HOXB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HOX2, HCFP3, HOX2I, Hox-2.9

UniProt

P14653

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human HOXB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GAGPGPYPPQHPPYGNEQTASFAPAYADLLSEDKETPCPSEPNTPTARTF

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_002135

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH3GLB1 Antibody Blocking Peptide
orb1502242 500 µg

SH3GLB1 Antibody Blocking Peptide

Sign In for Pricing
View Details
LIN7B Blocking peptide
orb1443469 500 µg

LIN7B Blocking peptide

Sign In for Pricing
View Details
Lentiviral mouse Pafah1b2 shRNA (UAS) - Lentiviral mouse Pafah1b2 shRNA (UAS, RFP) (25)
GTR15222083 1 Vial

Lentiviral mouse Pafah1b2 shRNA (UAS) - Lentiviral mouse Pafah1b2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
PRCC Recombinant Protein (Human)
RP024499 100 µg

PRCC Recombinant Protein (Human)

Sign In for Pricing
View Details
MVD (Mevalonate Pyrophosphate Decarboxylase, MPD, Diphosphomevalonate Decarboxylase, FP17780, Mevalonate (Diphospho) Decarboxylase, MDDase) (MaxLight 490)
MBS6201972-01 0.1 mL

MVD (Mevalonate Pyrophosphate Decarboxylase, MPD, Diphosphomevalonate Decarboxylase, FP17780, Mevalonate (Diphospho) Decarboxylase, MDDase) (MaxLight 490)

Sign In for Pricing
View Details
MVD (Mevalonate Pyrophosphate Decarboxylase, MPD, Diphosphomevalonate Decarboxylase, FP17780, Mevalonate (Diphospho) Decarboxylase, MDDase) (MaxLight 490)
MBS6201972-02 5x 0.1 mL

MVD (Mevalonate Pyrophosphate Decarboxylase, MPD, Diphosphomevalonate Decarboxylase, FP17780, Mevalonate (Diphospho) Decarboxylase, MDDase) (MaxLight 490)

Sign In for Pricing
View Details