Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADH4 Rabbit Polyclonal Antibody (HRP)

ADH4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ADH-2, HEL-S-4

UniProt

P08319

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ADH4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KFCLSPLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTF

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom2r48 Protein Vector (Rat) (pPB-N-His)
PV315819 500 ng

Vom2r48 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
DNAJB9 Knockout MES-OV Polyclonal Cells
ARG39156 1 Million

DNAJB9 Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
Rabbit Polyclonal L3MBTL2 Antibody [Janelia Fluor 646]
NBP3-06352JF646 0.1 mL

Rabbit Polyclonal L3MBTL2 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Gtf3c5 sgRNA CRISPR Lentivector set (Mouse)
K4089401 3x 1.0 µg

Gtf3c5 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
TCN1, CT (TCN1, TC1, Transcobalamin-1, Transcobalamin I)
MBS643492-01 0.2 mL

TCN1, CT (TCN1, TC1, Transcobalamin-1, Transcobalamin I)

Sign In for Pricing
View Details
TCN1, CT (TCN1, TC1, Transcobalamin-1, Transcobalamin I)
MBS643492-02 5x 0.2 mL

TCN1, CT (TCN1, TC1, Transcobalamin-1, Transcobalamin I)

Sign In for Pricing
View Details