Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXN Rabbit Polyclonal Antibody (FITC)

TXN Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TRX, TRDX, TRX1, Trx80

UniProt

P10599

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TXN

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEAT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

NP_003320

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MPP6 (M-phase Phosphoprotein 6, MPHOSPH6)
129822 50 µg

MPP6 (M-phase Phosphoprotein 6, MPHOSPH6)

Sign In for Pricing
View Details
DLL1 Mouse Monoclonal Antibody
AMM83190-01 1 Each

DLL1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
DLL1 Mouse Monoclonal Antibody
AMM83190-02 50 µL

DLL1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
DLL1 Mouse Monoclonal Antibody
AMM83190-03 100 µL

DLL1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD5 (CD5 Antigen, CD5 Molecule, LEU1, Lymphocyte Antigen CD5, Lymphocyte Antigen T1/Leu 1, Lymphocyte Glycoprotein T1/Leu1, p56 62, T cell Surface Glycoprotein CD5, T1) (MaxLight 405) discontinued
C2256-12K-ML405 100 µL

CD5 (CD5 Antigen, CD5 Molecule, LEU1, Lymphocyte Antigen CD5, Lymphocyte Antigen T1/Leu 1, Lymphocyte Glycoprotein T1/Leu1, p56 62, T cell Surface Glycoprotein CD5, T1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Chondroitin Sulfate Proteoglycan (NG2, CSPG) (MaxLight 550)
MBS6259607-01 0.1 mL

Chondroitin Sulfate Proteoglycan (NG2, CSPG) (MaxLight 550)

Sign In for Pricing
View Details