Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5 Rabbit Polyclonal Antibody (Biotin)

EIF5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EIF-5, EIF-5A

UniProt

Q6IBU0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human EIF5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RGMLDTHHKLCTFILKNPPENSDSGTGKKEKEKKNRKGKDKENGSVSSSE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLIC5 (Chloride intracellular channel protein 5) (Biotin) discontinued
030877-Biotin 200 µL

CLIC5 (Chloride intracellular channel protein 5) (Biotin) discontinued

Sign In for Pricing
View Details
LIMK1/2, phosphorylated (T508/505) (LIM Domain Kinase 1, LIMK-1, LIMK1, LIMK, LIM Domain Kinase 2, LIMK 2, LIMK2) discontinued
223911-01 50 µL

LIMK1/2, phosphorylated (T508/505) (LIM Domain Kinase 1, LIMK-1, LIMK1, LIMK, LIM Domain Kinase 2, LIMK 2, LIMK2) discontinued

Sign In for Pricing
View Details
LIMK1/2, phosphorylated (T508/505) (LIM Domain Kinase 1, LIMK-1, LIMK1, LIMK, LIM Domain Kinase 2, LIMK 2, LIMK2) discontinued
223911-02 100 µL

LIMK1/2, phosphorylated (T508/505) (LIM Domain Kinase 1, LIMK-1, LIMK1, LIMK, LIM Domain Kinase 2, LIMK 2, LIMK2) discontinued

Sign In for Pricing
View Details
Phospho-JNK1/2/3 (T183+T183+T221) Recombinant Rabbit mAb, BF680 conjugated
orb1587253 100 µL

Phospho-JNK1/2/3 (T183+T183+T221) Recombinant Rabbit mAb, BF680 conjugated

Sign In for Pricing
View Details
CHRND Rabbit Polyclonal Antibody (BF750)
orb2537712 100 µL

CHRND Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
2,2-Diethyl dispiro[3.1.3^{6}.1^{4}]decane-2,2-dicarboxylate
TDA15729-01 50 mg

2,2-Diethyl dispiro[3.1.3^{6}.1^{4}]decane-2,2-dicarboxylate

Sign In for Pricing
View Details