Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A11 Rabbit Polyclonal Antibody (HRP)

S100A11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MLN70, S100C, HEL-S-43

UniProt

P31949

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human S100A11

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_005611

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD247/CD3Z Protein, N-GST & C-His
YHD44102 100 μg

Recombinant Human CD247/CD3Z Protein, N-GST & C-His

Sign In for Pricing
View Details
SDCBP (Syndecan-binding Protein 1, Melanoma Differentiation-associated Protein 9, MDA9, MDA-9, Pro-TGF-alpha Cytoplasmic Domain-interacting Protein 18, TACIP18, Scaffold Protein Pbp1, SYCL, Syntenin-1, ST1) (PE)
133060-PE 100 µL

SDCBP (Syndecan-binding Protein 1, Melanoma Differentiation-associated Protein 9, MDA9, MDA-9, Pro-TGF-alpha Cytoplasmic Domain-interacting Protein 18, TACIP18, Scaffold Protein Pbp1, SYCL, Syntenin-1, ST1) (PE)

Sign In for Pricing
View Details
Penicillium notatum Allergen
51-38 1 Each

Penicillium notatum Allergen

Sign In for Pricing
View Details
Ndufv3 ORF Vector (Rat) (pORF)
ORF071203 1.0 µg DNA

Ndufv3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Abiraterone Isopropyl Ether-d7
440690 2.5 mg

Abiraterone Isopropyl Ether-d7

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Vascular Endothelial Growth Factor 121 (VEGF121)
MBS2121504-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Vascular Endothelial Growth Factor 121 (VEGF121)

Sign In for Pricing
View Details