Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS18 Rabbit Polyclonal Antibody (FITC)

RPS18 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KE3, S18, HKE3, KE-3, D6S218E

UniProt

P62269

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human RPS18

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_072045

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QPCR Kit DNA Mycoplasma Mmix
MOL8834 1 Each

QPCR Kit DNA Mycoplasma Mmix

Sign In for Pricing
View Details
PI 3-Kinase p85 alpha (Phosphatidylinositol-PI-3-Kinase) (MaxLight 405) discontinued
P4186-03-ML405 100 µL

PI 3-Kinase p85 alpha (Phosphatidylinositol-PI-3-Kinase) (MaxLight 405) discontinued

Sign In for Pricing
View Details
SCRIBBLE Rabbit Polyclonal Antibody (PerCP)
orb2467707 100 µL

SCRIBBLE Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Recombinant Human SMAD5 antisense gene protein 1 (SMAD5-AS1)
MBS1307931-01 0.02 mg (E-Coli)

Recombinant Human SMAD5 antisense gene protein 1 (SMAD5-AS1)

Sign In for Pricing
View Details
Recombinant Human SMAD5 antisense gene protein 1 (SMAD5-AS1)
MBS1307931-02 0.1 mg (E-Coli)

Recombinant Human SMAD5 antisense gene protein 1 (SMAD5-AS1)

Sign In for Pricing
View Details
Recombinant Human SMAD5 antisense gene protein 1 (SMAD5-AS1)
MBS1307931-03 0.02 mg (Yeast)

Recombinant Human SMAD5 antisense gene protein 1 (SMAD5-AS1)

Sign In for Pricing
View Details