Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFI1 Rabbit Polyclonal Antibody (FITC)

SFI1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PISD, hSfi1p, PPP1R139

UniProt

A8K8P3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SFI1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LELNTAHSARKQPRRPHFLLEPAQSQRPQKPQEHGLGMAQPAAPSLTRPF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

133kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_055590

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Human FKBP1B Polyclonal Antibody
MBS7137187-01 0.05 mL

Rabbit anti-Human FKBP1B Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Human FKBP1B Polyclonal Antibody
MBS7137187-02 0.1 mL

Rabbit anti-Human FKBP1B Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Human FKBP1B Polyclonal Antibody
MBS7137187-03 5x 0.1 mL

Rabbit anti-Human FKBP1B Polyclonal Antibody

Sign In for Pricing
View Details
Platelet-derived Growth Factor-BB, Active, Recombinant, Human, aa82-190 (PDGFB) (GMP) discontinued
587026-01 5 µg

Platelet-derived Growth Factor-BB, Active, Recombinant, Human, aa82-190 (PDGFB) (GMP) discontinued

Sign In for Pricing
View Details
Platelet-derived Growth Factor-BB, Active, Recombinant, Human, aa82-190 (PDGFB) (GMP) discontinued
587026-02 100 µg

Platelet-derived Growth Factor-BB, Active, Recombinant, Human, aa82-190 (PDGFB) (GMP) discontinued

Sign In for Pricing
View Details
DPP9 Human siRNA Oligo Duplex (Locus ID 91039)
SR314059 1 Kit

DPP9 Human siRNA Oligo Duplex (Locus ID 91039)

Sign In for Pricing
View Details