Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DARS Rabbit Polyclonal Antibody (Biotin)

DARS Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DARS, HBSL, aspRS

UniProt

P14868

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human DARS

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001340

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKAR1B, NT (cAMP-dependent Protein Kinase Type I-beta Regulatory Subunit) (AP) discontinued
P9102-91L4-AP 200 µL

PRKAR1B, NT (cAMP-dependent Protein Kinase Type I-beta Regulatory Subunit) (AP) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Aqp12 shRNA (UAS) - Lentiviral mouse Aqp12 shRNA (UAS) (25)
GTR15282941 1 Vial

Lentiviral mouse Aqp12 shRNA (UAS) - Lentiviral mouse Aqp12 shRNA (UAS) (25)

Sign In for Pricing
View Details
KDM2B, NT (Lysine-specific Demethylase 2B, JmjC Domain-containing Histone Demethylation Protein 1B, [Histone-H3]-lysine-36 Demethylase 1B, F-box/LRR-repeat Protein 10, F-box and Leucine-rich Repeat Protein 10, F-box Protein FBL10, Protein JEMMA, Jumonji Domain-containing EMSY-interactor Methyltransferase Motif Protein, CXXC-type Zinc Finger Protein 2, Protein-containing CXXC Domain 2, CXXC2, FBL10, JHDM1B, PCCX2, JHDM1b, FBXL10) (MaxLight 405) discontinued
K0138-40B-ML405 100 µL

KDM2B, NT (Lysine-specific Demethylase 2B, JmjC Domain-containing Histone Demethylation Protein 1B, [Histone-H3]-lysine-36 Demethylase 1B, F-box/LRR-repeat Protein 10, F-box and Leucine-rich Repeat Protein 10, F-box Protein FBL10, Protein JEMMA, Jumonji Domain-containing EMSY-interactor Methyltransferase Motif Protein, CXXC-type Zinc Finger Protein 2, Protein-containing CXXC Domain 2, CXXC2, FBL10, JHDM1B, PCCX2, JHDM1b, FBXL10) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Compound F0394-0013
MBS5801396 Inquire

Compound F0394-0013

Sign In for Pricing
View Details
Chil1 Mouse qPCR Primer Pair (NM_007695)
MP202433 200 Reactions

Chil1 Mouse qPCR Primer Pair (NM_007695)

Sign In for Pricing
View Details
3-exo-Ipratropium Bromide Monohydrate
425506-01 100 mg

3-exo-Ipratropium Bromide Monohydrate

Sign In for Pricing
View Details